LL-37 (Cathelicidin) Testing

MW: 4493.33 g/molHalf-life: Hours in tissue; rapidly cleared from plasma.

Only human cathelicidin antimicrobial peptide; broad-spectrum antimicrobial and immunomodulator.

Request LL-37 (Cathelicidin) Testing →View Sample CoA Pricing

Mechanism of action

Only human cathelicidin antimicrobial peptide; cleaved from hCAP18 precursor. Direct antimicrobial activity against bacteria, fungi, and enveloped viruses, plus immunomodulatory effects on neutrophils, macrophages, and epithelial cells.

Sequence & structure

LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES (37 residues)

Highly cationic amphipathic α-helix; strongly aggregation-prone in solution. Storage at high concentration drives oligomerization that affects activity.

Research areas

●Antimicrobial therapy research
●Wound healing
●Chronic inflammation
●COVID-19 research

What we test on LL-37 (Cathelicidin)

RP-HPLC purity, intact-mass LC-MS, SEC-HPLC for aggregation, LAL endotoxin.

Standard Immune & Anti-Inflammatory Panel

✓RP-HPLC purity
✓ESI-MS identity
✓Endotoxin (LAL, USP <85>)
✓SEC for LL-37 aggregation

Common impurities & failure modes

Aggregates / oligomers
SEC-HPLC quantifies; can represent >30% of material in poorly-stored vials.
Oxidation of internal residues
Met- and Trp-free, so primary oxidation pathway is via diffusion-mediated radical chemistry.
Truncation
Standard SPPS failures.
Endotoxin
An antimicrobial peptide with endotoxin contamination is self-defeating; LAL mandatory.

Related Immune & Anti-Inflammatory peptides

KPV

342.43 g/mol

C-terminal tripeptide of α-MSH; anti-inflammatory.

Thymagen / Thymogen

333.34 g/mol

Synthetic dipeptide bioregulator based on natural thymic peptides.

Thymosin Alpha-1 (TA-1)

3108.32 g/mol

28-residue thymic peptide; immunomodulator approved for hepatitis B/C in some countries (Zadaxin).

Thymulin (FTS-Zn)

847.85 g/mol

Nonapeptide thymic hormone requiring zinc for activity.