LL-37 (Cathelicidin) Testing

MW: 4493.33 g/molHalf-life: Hours in tissue; rapidly cleared from plasma.

Only human cathelicidin antimicrobial peptide; broad-spectrum antimicrobial and immunomodulator.

Mechanism of action

Only human cathelicidin antimicrobial peptide; cleaved from hCAP18 precursor. Direct antimicrobial activity against bacteria, fungi, and enveloped viruses, plus immunomodulatory effects on neutrophils, macrophages, and epithelial cells.

Sequence & structure

LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES (37 residues)

Highly cationic amphipathic α-helix; strongly aggregation-prone in solution. Storage at high concentration drives oligomerization that affects activity.

Research areas

  • Antimicrobial therapy research
  • Wound healing
  • Chronic inflammation
  • COVID-19 research

What we test on LL-37 (Cathelicidin)

RP-HPLC purity, intact-mass LC-MS, SEC-HPLC for aggregation, LAL endotoxin.

Standard Immune & Anti-Inflammatory Panel
  • RP-HPLC purity
  • ESI-MS identity
  • Endotoxin (LAL)
  • SEC for LL-37 aggregation

Common impurities & failure modes

  • Aggregates / oligomers

    SEC-HPLC quantifies; can represent >30% of material in poorly-stored vials.

  • Oxidation of internal residues

    Met- and Trp-free, so primary oxidation pathway is via diffusion-mediated radical chemistry.

  • Truncation

    Standard SPPS failures.

  • Endotoxin

    An antimicrobial peptide with endotoxin contamination is self-defeating; LAL mandatory.

Related Immune & Anti-Inflammatory peptides